DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG17239

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:227 Identity:62/227 - (27%)
Similarity:108/227 - (47%) Gaps:15/227 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVG-S 87
            ||.||:...:..:|:||::...|.::|||.|..:...:||..|:..  ::|.:    .:|.|| |
  Fly    23 RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTD--RETEF----LSVRVGSS 81

  Fly    88 VDLYNGKQIRVEEITINPNY-STLKTGIALLRLQEEITFSETVNAIPLSQDVPPMGSQVEVSGWG 151
            ...:.|:.:||..:.::..| .:....||::|||.::.....|:.|||:...|..||...|||||
  Fly    82 FTFFGGQVVRVSSVLLHEEYDQSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWG 146

  Fly   152 RTTESEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQVLCLGHGRRQGICSGDIGGPAVYQG 216
             ....:.|...::...:.:::...:|..:...:  :..|.:.....|:  ..||||.|||.|...
  Fly   147 -AIGFKKNYPMSILSASVDIVDQDQCRRSYGRK--ITKDMICAAAPGK--DACSGDSGGPLVSGN 206

  Fly   217 QLVGLGAQILGECG-GMLPERFISIAANYDWI 247
            :|||: .....||. ...|..:.::|....||
  Fly   207 KLVGI-VSFGKECAHPEYPGVYANVAELKPWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 60/225 (27%)
Tryp_SPc 25..250 CDD:238113 61/226 (27%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 60/225 (27%)
Tryp_SPc 24..237 CDD:238113 59/224 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.