DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and PRTN3

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:266 Identity:74/266 - (27%)
Similarity:110/266 - (41%) Gaps:52/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILVAAGVLEAQPQGRIAGGEDAVLGQLPYQAALSI---GGSYNCGAVIIGQRYALTALSCVCSD 70
            |.|:.:|...|   ..|.||.:|.....||.|:|.:   .||:.||..:|...:.|||..|:   
Human    15 LALLLSGAARA---AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCL--- 73

  Fly    71 GKDTPWAAVLFAVTVGSVDLYNGKQ--IRVEEITINPNYSTLK--TGIALLRLQEEITFSETVNA 131
             :|.|...|...:...:|......|  ..|.::.:| ||....  ..:.|::|......|.:|..
Human    74 -RDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLN-NYDAENKLNDVLLIQLSSPANLSASVAT 136

  Fly   132 IPL-SQDVP-PMGSQVEVSGWGRTTESEVNMHRTLQIGA----AEVMAPRECALANRDELLVADD 190
            :.| .||.| |.|:|....||||             :||    |:|:          .||.|...
Human   137 VQLPQQDQPVPHGTQCLAMGWGR-------------VGAHDPPAQVL----------QELNVTVV 178

  Fly   191 QVLCLGHG-------RRQGICSGDIGGPAVYQGQLVGLGAQILGECGGML-PERFISIAANYDWI 247
            ...|..|.       |:.|||.||.|||.:..|.:.|:.:.::..|...| |:.|..:|...|||
Human   179 TFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWI 243

  Fly   248 QQQLQQ 253
            :..|::
Human   244 RSTLRR 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 67/243 (28%)
Tryp_SPc 25..250 CDD:238113 69/245 (28%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 69/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.