DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and KLK10

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:270 Identity:71/270 - (26%)
Similarity:111/270 - (41%) Gaps:36/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTLTIGLILVAAGVLEAQPQGRI---AGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTAL 64
            |.|.:..:..|...|..|...|:   |.|.....|..|:|.:|..|.|::|..|::.|.:.|||.
Human    21 LPLLMAQLWAAEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAA 85

  Fly    65 SCVCSDGKDTPWAAVLFAVTVGS--VDLYNGKQI-RVEEITINPNY----------STLKTGIAL 116
            .|    |....||      .||.  :.|..|:|: |.....::|.|          .|.:..:.|
Human    86 HC----GNKPLWA------RVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLML 140

  Fly   117 LRLQEEITFSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALAN 181
            |:|...:.....|.|:.|.......|.|.:|:|||.|....|..::.|...:..:::|:||    
Human   141 LKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKEC---- 201

  Fly   182 RDELL---VADDQVLCLGHGRRQGICSGDIGGPAVYQGQLVGLGAQILGECG-GMLPERFISIAA 242
              |:.   |..:.::|.|..|.|..|..|.|||.|....|.|:.:..:..|| ...|..:..|..
Human   202 --EVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICK 264

  Fly   243 NYDWIQQQLQ 252
            ...||.:.::
Human   265 YMSWINKVIR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 64/242 (26%)
Tryp_SPc 25..250 CDD:238113 65/244 (27%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 64/238 (27%)
Tryp_SPc 49..269 CDD:214473 62/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.