DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and PRSS2

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:264 Identity:69/264 - (26%)
Similarity:118/264 - (44%) Gaps:22/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTLTIGLILVAAGVLEAQP---QGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTAL 64
            :.|.:.|..|||.|  |.|   ..:|.||.......:|||.:|: .|.:.||..:|.:::.::|.
Human     1 MNLLLILTFVAAAV--AAPFDDDDKIVGGYICEENSVPYQVSLN-SGYHFCGGSLISEQWVVSAG 62

  Fly    65 SCVCS------DGKDTPWAAVLFAVTVGSVDLYNGKQ--IRVEEITINPNYS--TLKTGIALLRL 119
            .|..|      .|:...:..:...:...::::..|.:  |...:|..:|.|:  ||...|.|::|
Human    63 HCYKSAINSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKL 127

  Fly   120 QEEITFSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDE 184
            ......:..|:||.|....|..|::..:||||.|..|..:....||...|.|::..||..:...:
Human   128 SSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGK 192

  Fly   185 LLVADDQVLCLG--HGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISIAANYDWI 247
            :   .:.:.|:|  .|.:.. |.||.|||.|..|:|.|:.:...|......|..:..:....|||
Human   193 I---TNNMFCVGFLEGGKDS-CQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWI 253

  Fly   248 QQQL 251
            :..:
Human   254 KDTI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 59/234 (25%)
Tryp_SPc 25..250 CDD:238113 61/236 (26%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 59/234 (25%)
Tryp_SPc 24..256 CDD:238113 61/236 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.