DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and PRSS1

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:224 Identity:61/224 - (27%)
Similarity:99/224 - (44%) Gaps:26/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILVAAGVLEAQP---QGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSD 70
            |||.......|.|   ..:|.||.:.....:|||.:|: .|.:.||..:|.:::.::|..|..| 
Human   230 LILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLN-SGYHFCGGSLINEQWVVSAGHCYKS- 292

  Fly    71 GKDTPWAAVLFAVTVG--SVDLYNGKQ--IRVEEITINPNY--STLKTGIALLRLQEEITFSETV 129
                     ...|.:|  ::::..|.:  |...:|..:|.|  .||...|.|::|......:..|
Human   293 ---------RIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARV 348

  Fly   130 NAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQVLC 194
            :.|.|....|..|::..:||||.|..|..:....||...|.|::..:|..:...::   ...:.|
Human   349 STISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKI---TSNMFC 410

  Fly   195 LG--HGRRQGICSGDIGGPAVYQGQLVGL 221
            :|  .|.:.. |.||.|||.|..|||.|:
Human   411 VGFLEGGKDS-CQGDSGGPVVCNGQLQGV 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 56/206 (27%)
Tryp_SPc 25..250 CDD:238113 56/205 (27%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 56/206 (27%)
Tryp_SPc 249..467 CDD:238113 56/205 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.