DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and LOC560023

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:268 Identity:70/268 - (26%)
Similarity:110/268 - (41%) Gaps:61/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILVAAGVLEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDT 74
            :::|..|.:|..| ||.||::.|...:.||.:|.:...:.||..:|..::.|||..|        
Zfish    30 LVLAVMVRDAFSQ-RIIGGQEVVPYSIKYQVSLQVDRKHFCGGTLIQPQWVLTAAHC-------- 85

  Fly    75 PW--AAVLFAVTVGSVDLYNGKQIRVEE--------------ITINPNYSTLKTGIALLRLQEEI 123
             |  |:|:..|       .:...:.|||              :..||  .|....|.:::|    
Zfish    86 -WRPASVIQVV-------LSEHNLAVEEGFEQVCTVAKVFSHVAYNP--KTFNNDIMIIKL---- 136

  Fly   124 TFSETVNA------IPLSQDVPPM--GSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALA 180
            |....:||      :| :.|.|.:  ||...|||||.|  ...|.:.:..:.|.:|.....|.|.
Zfish   137 TAPAQINAYVQPALLP-TADTPELAGGSSCTVSGWGVT--RLYNFYLSPILRAVDVEIFSSCQLY 198

  Fly   181 NRDELLVADDQVLCLG--HGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISIAAN 243
            ....:   :|.::|.|  .|.:.. |.||.|||.:..|.|.|:.:..:|......|..:..: .|
Zfish   199 YYYRV---NDNMICAGSRFGGKDS-CQGDSGGPLICDGYLEGIVSWGIGCALPYYPGVYTKV-RN 258

  Fly   244 Y----DWI 247
            |    |||
Zfish   259 YNRWIDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 64/252 (25%)
Tryp_SPc 25..250 CDD:238113 65/253 (26%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 63/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.