DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and prozb

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001313449.1 Gene:prozb / 558106 ZFINID:ZDB-GENE-120816-1 Length:395 Species:Danio rerio


Alignment Length:228 Identity:54/228 - (23%)
Similarity:89/228 - (39%) Gaps:54/228 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVGSVDLYNGKQIRVEEITINPN 106
            |:..|...|..||:||:..||:.:|:      |....:.|.|.||    .:...:||...|.:..
Zfish   196 LNASGHDVCHGVILGQKSILTSATCM------TALQDLHFTVAVG----VSTAAVRVSSWTPHKR 250

  Fly   107 Y-STLKTGIALLRLQEEITFSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAE 170
            : |.....:..|.|||  .|...::.:||.  :|            ....||..:.|..:.|.||
Zfish   251 FLSGPDDDLCFLELQE--PFPPNISTVPLC--LP------------EKDYSENILMRAGREGVAE 299

  Fly   171 ------VMAPRECALANRDEL---LVADDQVLCLGHGRRQGI----CSGDIGGP-AVYQGQ---L 218
                  .::..:|    ||.|   .|..:::.|:   :|:..    |:...|.| |..:|:   |
Zfish   300 GGATYSYLSLDDC----RDALNLTFVMTNKMFCM---KRESAGSERCTVSSGSPAATLEGKTAFL 357

  Fly   219 VGLGAQILGECGGMLPERFISIAANYDWIQQQL 251
            .|:... .|.||..|  .|..::....|::..|
Zfish   358 TGVSLS-AGRCGDTL--LFTKLSRYLHWLRPLL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 52/222 (23%)
Tryp_SPc 25..250 CDD:238113 53/225 (24%)
prozbNP_001313449.1 GLA 25..88 CDD:214503
EGF_CA 89..125 CDD:238011
FXa_inhibition 139..167 CDD:291342
Tryp_SPc 182..384 CDD:304450 53/223 (24%)
Tryp_SPc 182..382 CDD:214473 52/221 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.