DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and si:dkey-21e2.16

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001038273.1 Gene:si:dkey-21e2.16 / 556598 ZFINID:ZDB-GENE-050208-698 Length:251 Species:Danio rerio


Alignment Length:276 Identity:79/276 - (28%)
Similarity:118/276 - (42%) Gaps:66/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTIGLILVAAGVLEAQPQGR--IAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCV 67
            :.|.|:|:.:.|.:.....|  |..|.:|.....||..:|.|.|.:.||..:|.:::.|||..| 
Zfish     4 IIISLLLLVSLVPDLTYTARVGIEDGTEAKPHSRPYMVSLQIKGWHICGGSLITEQFVLTAAHC- 67

  Fly    68 CSDGKDTPW-AAVLFAVTVGSVDLYNGKQIRVEEITI---NPNY--STLKTGIALLRLQEEITFS 126
                    | ...:..|.||:.||...|.....::|.   :|:|  |:.|..|.||:|.:::|.|
Zfish    68 --------WEKGDVITVVVGAHDLSGNKTYDSFDVTSYIPHPDYKQSSYKNDILLLKLNKKVTLS 124

  Fly   127 ETVNAIPLSQDVPPMGSQVE------VSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDEL 185
            ..|..|.|    |..|..||      |:||||..                |..||...|...|.:
Zfish   125 NNVGLISL----PKEGENVEADTLCSVAGWGRLW----------------VRGPRPGHLREADTV 169

  Fly   186 LVADDQ-------------VLCL-GHGRRQGICSGDIGGPAVYQGQLVGLGA---QILGECGGML 233
            ::.|::             ::|: |||   |.||||.|||.|....:||:.:   :.|  |...|
Zfish   170 IMTDEECKRRWEIKFKVSKMICVYGHG---GSCSGDSGGPLVCGDTVVGVTSFTDRYL--CNSRL 229

  Fly   234 -PERFISIAANYDWIQ 248
             |..:..|:|...||:
Zfish   230 RPNVYAKISAYIPWIK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 73/254 (29%)
Tryp_SPc 25..250 CDD:238113 74/254 (29%)
si:dkey-21e2.16NP_001038273.1 Tryp_SPc 26..247 CDD:238113 74/254 (29%)
Tryp_SPc 26..244 CDD:214473 72/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.