DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and XB5758585

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001011293.1 Gene:XB5758585 / 496746 XenbaseID:XB-GENE-5758586 Length:248 Species:Xenopus tropicalis


Alignment Length:252 Identity:60/252 - (23%)
Similarity:106/252 - (42%) Gaps:27/252 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILVAAGVLEAQP--QGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGK 72
            :|:..||:.|.|  ..:|.|..:.......:|...:..|...||..:|..|:.::|.||     .
 Frog     5 VLLFLGVVAASPLVDDKIIGEYECAPHSQKWQVYFTYKGYPWCGGSLISSRWIISAASC-----N 64

  Fly    73 DTPWAAVLFAVTVGSVDLY----NGKQIRVEEITINPNYSTL--KTGIALLRLQEEITFSETVNA 131
            .:|...:   ..:|..|:.    ..:.|:||:...:..|..|  ...|.|::|.|...|::.|..
 Frog    65 QSPKYLI---AHLGKHDITREEGTEQHIQVEKTFPHNRYLGLSDSNNIMLVKLAEPAQFNQFVQP 126

  Fly   132 IPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPREC-ALANRDELLVADDQVLCL 195
            |.::...|..|...:|||:|............||.....::....| |..:..::   ...::|.
 Frog   127 IKVASSCPREGKVCQVSGFGNLNSYAEKYPDRLQCLDLPILPESSCDAYFSPKKM---HTNLMCA 188

  Fly   196 GHGR-RQGICSGDIGGPAVYQGQLVGLGAQIL--GECGGM-LPERFISIAANYDWIQ 248
            |..: .:..|.||.|||.:.:|:|.|:   ||  .||.|. :|..::.:....:|:|
 Frog   189 GFAQDDKDSCQGDAGGPLICKGELYGI---ILWGNECSGRGIPGVYLKVCNFTNWMQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 53/233 (23%)
Tryp_SPc 25..250 CDD:238113 55/235 (23%)
XB5758585NP_001011293.1 Tryp_SPc 21..240 CDD:214473 53/232 (23%)
Tryp_SPc 22..244 CDD:238113 55/235 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.