DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and try10

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001011209.1 Gene:try10 / 496640 XenbaseID:XB-GENE-6453489 Length:243 Species:Xenopus tropicalis


Alignment Length:267 Identity:75/267 - (28%)
Similarity:122/267 - (45%) Gaps:43/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTLTIGLILVAAGVLEAQP---QGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALT 62
            ||..|...|:    |:..|||   ..:|.||...   .:|||.:|:.|..: ||..:|.:.:.::
 Frog     1 MKTLLLFSLL----GLAVAQPIEDDDKIVGGYHC---SVPYQVSLNAGYHF-CGGSLINEHWVVS 57

  Fly    63 ALSCVCSDGKDTPWAAVLFAVTVG--SVDLYNGKQ--IRVEEITINPNYS--TLKTGIALLRLQE 121
            |..|..|.          ..:.:|  :::|..|.:  |:..:|..:|.|:  |:...|.|::|||
 Frog    58 AAHCYQSK----------MELRIGENNIELLEGTEQFIQSAKIIRHPQYNSWTIDNDIMLIQLQE 112

  Fly   122 EITFSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELL 186
            ....:..|..|||..:.||:||...:||||.|..:.||....||...|.:::.:||..:....: 
 Frog   113 PAQLNNEVQPIPLPTECPPVGSICLISGWGNTLSNGVNYPDLLQCIEAPILSDQECRQSYPGSI- 176

  Fly   187 VADDQVLCLGHGRRQGI--CSGDIGGPAVYQGQLVGL-----GAQILGECGGMLPERFISIAANY 244
              .|.::|:|: ...||  |.||.|||.|..|:|.|:     |..:.|     .|..:..:....
 Frog   177 --TDNMICVGY-LEGGIDSCQGDSGGPVVCDGELQGVVSWGRGCALPG-----YPGVYTKVCNYL 233

  Fly   245 DWIQQQL 251
            .||:..:
 Frog   234 SWIRDTI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 65/235 (28%)
Tryp_SPc 25..250 CDD:238113 67/237 (28%)
try10NP_001011209.1 Tryp_SPc 24..239 CDD:238113 67/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.