DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and LOC496633

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001011204.1 Gene:LOC496633 / 496633 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:261 Identity:60/261 - (22%)
Similarity:108/261 - (41%) Gaps:24/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTLTIGLILVAAGVLEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALS 65
            |.|.:.:.|.:.||..|:   ..:|.||.:......|:|...:......||..::..|:.::|..
 Frog     2 MPLWILLFLAVAAAAPLD---DDKIVGGYECTPHSQPWQVYFTQENQVFCGGSLVTPRWIISAAH 63

  Fly    66 CVCSDGKDTPWAAVLFAVTVGSVDLY----NGKQIRVEEITINPNY--STLKTGIALLRLQEEIT 124
            |.     .||...|   ..:|..||.    ..:.|:||.|..:.:|  :.:...|.|::|.:...
 Frog    64 CY-----RTPKTLV---AHLGDHDLTKEEGTEQHIQVENIYKHFSYKDNDVDHDIMLVKLAKPAQ 120

  Fly   125 FSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEV-NMHRTLQIGAAEVMAPRECALANRDELLVA 188
            :::.|..||:::..|..|::..|||:|......: .....||.....|::...|..:.|.   :.
 Frog   121 YNQYVQPIPVARSCPREGTECLVSGYGNMRSDNIGEFPDRLQCVDVPVLSDSSCKASYRG---LF 182

  Fly   189 DDQVLCLG--HGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISIAANYDWIQQQL 251
            .:.:.|.|  .|.:.. |..|.|||.|..|:|.|:.:...|......|..:..:.....|:|..:
 Frog   183 TENMFCAGFLEGGKDS-CQVDSGGPLVCNGELYGVVSWGQGCAERNAPGVYAKVCNYLGWVQDII 246

  Fly   252 Q 252
            :
 Frog   247 E 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 52/231 (23%)
Tryp_SPc 25..250 CDD:238113 54/233 (23%)
LOC496633NP_001011204.1 Tryp_SPc 23..245 CDD:238113 54/233 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.