DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and prss2

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001011202.1 Gene:prss2 / 496627 XenbaseID:XB-GENE-6065254 Length:243 Species:Xenopus tropicalis


Alignment Length:257 Identity:64/257 - (24%)
Similarity:109/257 - (42%) Gaps:23/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTLTIGLILVAAGVLEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALS 65
            |||.    ||.|..|...|....:|.||.......:||..:|: .|.:.||..:|..::.::|..
 Frog     1 MKLL----LICVLLGAAAAFDDDKIIGGSTCARNSVPYIVSLN-SGYHFCGGSLISNQWVVSAAH 60

  Fly    66 CVCSDGKDTPWAAVLFAVTVGSVDLYNGKQ--IRVEEITINPNYS--TLKTGIALLRLQEEITFS 126
            |.        .|:|...:...::.|..|.:  |...::..:|:|:  |:...|.|::|....:.:
 Frog    61 CY--------KASVQVRLGEHNIALSEGTEQFINSAKVIRHPSYNSRTIDNDIMLIKLASPASLN 117

  Fly   127 ETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQ 191
            ..||.:.|.......|:...|||||..:.:..|....||...|.::...:|:.|...::   .:.
 Frog   118 SAVNTVALPSSCAAAGTSCLVSGWGNLSTTTSNYPDLLQCLNAPILTTAQCSGAYPGQI---TNN 179

  Fly   192 VLCLG--HGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISIAANYDWIQQQL 251
            :.|.|  .|.:.. |.||.|||.|..|:|.|:.:..:|......|..:..:.....|||..:
 Frog   180 MFCAGFLEGGKDS-CQGDSGGPVVCNGELQGVVSWGIGCAQRNYPGVYAKVCNYNSWIQSTI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 53/228 (23%)
Tryp_SPc 25..250 CDD:238113 56/230 (24%)
prss2NP_001011202.1 Tryp_SPc 21..239 CDD:238113 56/230 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.