DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and epsilonTry

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:283 Identity:74/283 - (26%)
Similarity:125/283 - (44%) Gaps:59/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTLTIGLILVA-AGV----LEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYA 60
            :|..:.:.::..| ||.    |..|..|||.||.:..:...|||.:|...||:.||..|......
  Fly     2 LKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIV 66

  Fly    61 LTALSCVCS-DGKDTPWAAVLFAVTVGSVDLYNGKQIR-VEEITINPNYS--TLKTGIALLRLQE 121
            :||..|:.| :.||       ..:.|||....:|..:. |.....:..|:  |:...||::|::.
  Fly    67 ITAAHCLQSIEAKD-------LKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIES 124

  Fly   122 EITFSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELL 186
            :::|..::..|.::...|..|:...||||| ||||          |.:.:          .|.||
  Fly   125 DLSFRSSIREIRIADSNPREGATAVVSGWG-TTES----------GGSTI----------PDHLL 168

  Fly   187 VADDQVL----C----LGHGRR------------QGICSGDIGGPAVYQGQLVGLGAQILGECGG 231
            ..|.:::    |    .|:|::            :..|.||.|||.|...:|||:.:...| ||.
  Fly   169 AVDLEIIDVSRCRSDEFGYGKKIKDTMLCAYAPHKDACQGDSGGPLVSGDRLVGVVSWGYG-CGD 232

  Fly   232 M-LPERFISIAANYDWIQQQLQQ 253
            : .|..:..:|..::||::..::
  Fly   233 VRYPGVYADVAHFHEWIERTAEE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 65/247 (26%)
Tryp_SPc 25..250 CDD:238113 66/249 (27%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 65/247 (26%)
Tryp_SPc 31..252 CDD:238113 66/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.