DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG5255

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:270 Identity:88/270 - (32%)
Similarity:126/270 - (46%) Gaps:39/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTLTIGLILV---AAGVLEAQPQ---GRIAGGEDAVLGQLPYQAAL-SIG-GSYNCGAVIIGQRY 59
            |.:.:.|:|.   ||..:...||   .||.|||:|..|..|||.:| .|| |:::||..||.:|:
  Fly     2 LLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERW 66

  Fly    60 ALTALSCVCSDGKDTPWAAVLFAVTVGSVDLY-NG-KQIRVEEITINPNYSTLK--TGIALLRLQ 120
            .:||..  |:.|:.    |..|.|..|:.||: || |....:.|..:.||:..|  ..||||.|.
  Fly    67 IITAAH--CTRGRQ----ATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLN 125

  Fly   121 EEITFSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIG--------AAEV-MAPRE 176
            |.|.|......:.|..:....||::.::|||           ||.:|        :.|| ..|.|
  Fly   126 ESIVFDNATQPVELDHEALVPGSRLLLTGWG-----------TLSLGGDVPARLQSLEVNYVPFE 179

  Fly   177 CALANRDELLVADDQVLCLGHGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISIA 241
            ...|..|.....|...:|..:.:.:|.|.||.|||.|:.|:||.|....| .|....|:...||:
  Fly   180 QCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGL-PCAKGYPDAHASIS 243

  Fly   242 ANYDWIQQQL 251
            ..:|:|:..|
  Fly   244 YYHDFIRTHL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 79/237 (33%)
Tryp_SPc 25..250 CDD:238113 79/239 (33%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 79/237 (33%)
Tryp_SPc 30..252 CDD:238113 79/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.