DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG31266

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:277 Identity:84/277 - (30%)
Similarity:131/277 - (47%) Gaps:41/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTLTIGLILVA------------------AGV-----LEAQPQGRIAGGEDAVLGQLPYQAALSI 44
            ||:.:||.|:|                  |.:     .||.||||:.||..|..|..|:.|::..
  Fly     7 LTVLLGLTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQN 71

  Fly    45 GGSYN-CGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVGSVDLYNGKQIRVEEITINPNYS 108
            ..||: |||:|:.:.:.|||.|||..   ..|...::...||...||| .....|.:|.::.|:.
  Fly    72 AYSYHLCGAIILDETWVLTAASCVAG---LRPLNLLVVTGTVDWWDLY-APYYTVSQIHVHCNFD 132

  Fly   109 --TLKTGIALLRLQEEITFSETVNAIPLSQDVPPM--GSQVEVSGWGRTTESEVNMHRTLQIGAA 169
              .....||||:|..:|.|::....|.|: |:..:  |.::..:||| ::|:.....|.||..:.
  Fly   133 KPLYHNDIALLQLSSKIEFNDVTKNITLA-DIDELEEGDKLTFAGWG-SSEAMGTYGRYLQEASG 195

  Fly   170 EVMAPREC--ALANRDELLVADDQVLCLGHGRRQGICSGDIGGPAV-YQGQLVGLGAQILGECGG 231
            ..:....|  .|.|:|::   |...:|:.....||.|.||.|||.: .|.:|||:|...: .||.
  Fly   196 TYLPVDACREKLQNQDDV---DLGHVCVQMDAGQGACHGDTGGPLIDEQQRLVGIGNWGV-PCGR 256

  Fly   232 MLPERFISIAANYDWIQ 248
            ..|:.:...|..:|||:
  Fly   257 GYPDVYARTAFYHDWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 70/230 (30%)
Tryp_SPc 25..250 CDD:238113 71/232 (31%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 70/230 (30%)
Tryp_SPc 52..275 CDD:238113 71/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.