DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG4053

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:244 Identity:73/244 - (29%)
Similarity:119/244 - (48%) Gaps:40/244 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RIAGGEDAVLGQLPYQAAL-SIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFA----- 82
            ||.||::|..|..|||.:: :|..::.|..||:.:::.|||..|           |:.|:     
  Fly    34 RIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHC-----------ALDFSIEDLR 87

  Fly    83 VTVGSVD-LYNGKQIRVEEITINPNYS---TLKTGIALLRLQEEITFSETVNAIPLSQDVPPMGS 143
            :.||:.| |..|:.:..:|..::..|.   .....|||:.:.|.|.|::....:.||::.||.||
  Fly    88 IIVGTNDRLEPGQTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVELSREQPPAGS 152

  Fly   144 QVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQVLCLGH-----GRRQGI 203
            .|.::||| ..||.....:.||.....::|..||    |:.....|.  :.:||     ...:|.
  Fly   153 TVTLTGWG-APESSYPTVQYLQTLNLTIIAHEEC----RERWDFHDG--IDIGHICTFTREGEGA 210

  Fly   204 CSGDIGGPAVYQGQLVGL---GAQILGECGGMLPERFISIAANYDWIQQ 249
            ||||.|||.:::|:||||   |.    .||..:|:.:.:.....|||::
  Fly   211 CSGDSGGPLMWEGKLVGLVNWGR----ACGVGMPDMYANTVYYQDWIRR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 71/240 (30%)
Tryp_SPc 25..250 CDD:238113 72/243 (30%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 71/240 (30%)
Tryp_SPc 35..256 CDD:238113 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.