DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG17477

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:254 Identity:71/254 - (27%)
Similarity:110/254 - (43%) Gaps:56/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IAGGEDAVLGQLPYQAAL-SIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVGSV 88
            |.||::|..|..|||.:| ::.||:.||..||..|:.:||..||    |..|.:.:  .|..|::
  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCV----KGYPTSRL--QVATGTI 85

  Fly    89 DLYN-GKQIRVEEITINPNYSTLK--TGIALLRLQEEITFSETVNAIPLSQDVPPMG-SQVEVSG 149
            .... |.....:.|.::.||.:.|  ..|.||.|.|.|||:....|:.|.....|.| |::..:|
  Fly    86 RYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTG 150

  Fly   150 WGRTT----------------------ESEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQV 192
            ||..:                      ||.::.:..|::|...:.|.|:..:             
  Fly   151 WGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANI------------- 202

  Fly   193 LCLGHGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISIAANYDWIQQQL 251
                     |.|.||.|||.|:||.|||: ......|...:|:.|::|....||::|.:
  Fly   203 ---------GACHGDSGGPLVHQGTLVGI-LNFFVPCAQGVPDIFMNIMYYRDWMRQTM 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 69/248 (28%)
Tryp_SPc 25..250 CDD:238113 70/251 (28%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 70/251 (28%)
Tryp_SPc 27..246 CDD:214473 68/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.