DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG16749

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:278 Identity:74/278 - (26%)
Similarity:121/278 - (43%) Gaps:56/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTLTIGLILVAAGVLEAQPQ-GRIAGGEDAVLGQLPYQAAL-SIGGSYNCGAVIIGQRYALTALS 65
            |.|.:..:|..||:....|| ||:..|.|:.:.:.|:..:: ...||::||..||.:::.:||..
  Fly     7 LCLAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAH 71

  Fly    66 CVCSDGKDTPWAAVLFAVTVGSVDLYNGKQIRVEEI----TINPNYSTLKTGIALLRLQEEITFS 126
              |:||:.....:|.:.||  .::......:||::|    ..|| |:.....|:||.::|...| 
  Fly    72 --CTDGRKASDLSVQYGVT--KINATGPNVVRVKKIIQHEDYNP-YNNYANDISLLLVEEPFEF- 130

  Fly   127 ETVNAIPLSQDVPPM---------GSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANR 182
            :.|...|:.  :|.:         |.:..:.|||....... :..|||    ||           
  Fly   131 DGVTVAPVK--LPELAFATPQTDAGGEGVLIGWGLNATGGY-IQSTLQ----EV----------- 177

  Fly   183 DELLVADDQVLCLGHGRR---------------QGICSGDIGGPAVYQGQLVGLGAQILGECG-G 231
             ||.|..|:.....||.|               :|.||||.|||.:|.||.||:.:..:..|. .
  Fly   178 -ELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVA 241

  Fly   232 MLPERFISIAANYDWIQQ 249
            ..|..:..::...|||::
  Fly   242 PYPGVYCKVSQYVDWIKK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 64/252 (25%)
Tryp_SPc 25..250 CDD:238113 65/255 (25%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 64/252 (25%)
Tryp_SPc 30..259 CDD:238113 65/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.