DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and proca

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_956650.1 Gene:proca / 393327 ZFINID:ZDB-GENE-060824-5 Length:434 Species:Danio rerio


Alignment Length:259 Identity:71/259 - (27%)
Similarity:115/259 - (44%) Gaps:55/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IAGGEDAVLGQLPYQA-ALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVGSV 88
            :.||.....|:.|:|| .|:..|.::||.|:|.:.:.|||..|:.:..|        |:|.:|. 
Zfish   195 VMGGNVGKRGESPWQALILNHLGRFHCGGVLIDENWVLTAAHCLETSSK--------FSVRLGD- 250

  Fly    89 DLYNGKQIRVEEITI-------NPNYS--TLKTGIALLRLQEEITFSETVNAIPLSQDVPPM--- 141
              |...:....|:|:       :|.|:  |:...||||||...:.||..:    |...:|.:   
Zfish   251 --YQRFKFEGSEVTLPVKQHISHPQYNPITVDNDIALLRLDGPVKFSTYI----LPACLPSLELA 309

  Fly   142 -------GSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQVLCLG-HG 198
                   |:...::|||:..:|..:.:.||......::..:||:....:.|   .|.:||.| .|
Zfish   310 KRMLHRNGTVTIITGWGKNNQSATSYNSTLHYVELPIVDNKECSRHMMNNL---SDNMLCAGVLG 371

  Fly   199 RRQGICSGDIGGPAVYQGQ----LVGLGAQILGE-CGGMLPER-----FISIAANYDWIQQQLQ 252
            :.:..|.||.|||.:....    ||||.:  .|| ||    :|     :..:|:..|||....|
Zfish   372 QVKDACEGDSGGPMMTLFHDTWFLVGLVS--WGEGCG----QRDKLGIYTKVASYLDWIDSVRQ 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 68/252 (27%)
Tryp_SPc 25..250 CDD:238113 70/255 (27%)
procaNP_956650.1 GLA 23..84 CDD:214503
EGF_CA 85..119 CDD:238011
FXa_inhibition 128..165 CDD:291342
Tryp_SPc 195..427 CDD:238113 70/255 (27%)
Tryp_SPc 197..424 CDD:214473 68/250 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.