DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG34043

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001033893.2 Gene:CG34043 / 3885606 FlyBaseID:FBgn0054043 Length:338 Species:Drosophila melanogaster


Alignment Length:234 Identity:49/234 - (20%)
Similarity:76/234 - (32%) Gaps:91/234 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 NCGAVIIGQRYALTALSCVCSD-----GKDTPWA---AVLF--------AVTVGSVDLYNGKQIR 97
            :|...||..|..||:.||:.||     |::...|   ||.|        ...||.:|:|      
  Fly    41 HCYGNIIQSRLVLTSASCLLSDNDFVNGRELLNADELAVSFKGEDLNELIYLVGGIDVY------ 99

  Fly    98 VEEITINP--NYSTLKTGIALLRLQEEITFSETVN---AIPLSQDVP--PMGSQVEVSGWGRTTE 155
                   |  |:|:|...||:|.|..::..||..:   .:....|:.  |:...||...|..   
  Fly   100 -------PQFNFSSLDNDIAILSLSTQLPLSERNDIEWVLVADYDITDFPLEEGVESYVWKN--- 154

  Fly   156 SEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQVLCLGHGRRQGICSGDIGGPAVYQGQLVG 220
                                            ||.:.:..|:|             .:::..|||
  Fly   155 --------------------------------ADGENIYPGYG-------------VIHESNLVG 174

  Fly   221 L---GAQILGECGGML----PERFISIAANYDWIQQQLQ 252
            :   |..:..:....|    |.||..:.....||...:|
  Fly   175 IISYGLPLKNKRESNLEVRRPNRFTQLNPYLSWIYTIIQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 46/227 (20%)
Tryp_SPc 25..250 CDD:238113 48/230 (21%)
CG34043NP_001033893.2 Tryp_SPc 24..211 CDD:304450 48/230 (21%)
Tryp_SPc 24..208 CDD:214473 46/227 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.