DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG11192

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:260 Identity:76/260 - (29%)
Similarity:126/260 - (48%) Gaps:24/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILVA-AGVLEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGK 72
            :.||| ||.......|||.|||.|.:.:.|||.::.:.|.:.||..|||....|||..|.     
  Fly    11 MALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCF----- 70

  Fly    73 DTPWAAVLFAVTVGSVDLYNGKQI-RVEEITINPNYS--TLKTGIALLRLQEEITFSETVNAIPL 134
            :.||::..:.|.|||.:..:|..: .:..:..:.:|:  :....:|||.|..::.|:|.:..:||
  Fly    71 EDPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPL 135

  Fly   135 S--QDVPPMGSQVEVSGWGRTTE-----SEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQV 192
            :  .|.|...::::|||||...|     .||.:...|:....:::...:|..| ..::|....::
  Fly   136 AALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRA-YSQVLPITRRM 199

  Fly   193 LCLGHGRRQGICSGDIGGP----AVYQG--QLVGLGAQILGECGGMLPERFISIAANYDWIQQQL 251
            :|.....|.. |.||.|||    |..:|  :|.|:.:..||......|..:.::||...||.:||
  Fly   200 ICAARPGRDS-CQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQL 263

  Fly   252  251
              Fly   264  263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 66/238 (28%)
Tryp_SPc 25..250 CDD:238113 67/240 (28%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 66/238 (28%)
Tryp_SPc 28..262 CDD:238113 67/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.