DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and Prss56

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_003750778.1 Gene:Prss56 / 363274 RGDID:1563955 Length:607 Species:Rattus norvegicus


Alignment Length:255 Identity:70/255 - (27%)
Similarity:100/255 - (39%) Gaps:47/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVGS 87
            |||.||..|.||..|:...|.:||...||.|::...:.|||..|......:..|..:|.....|.
  Rat   110 GRIVGGSTAPLGAWPWLVRLQLGGLPLCGGVLVAASWVLTAAHCFAGASNELLWTVMLAEGPQGE 174

  Fly    88 VDLYNGKQIRVEEITINPNY--STLKTGIALLRLQEEITFSETVNAI--PLSQDVPPMGSQVEVS 148
                ..::::|..|..:|.:  .|....:||::|...:........|  |.....||.|:...::
  Rat   175 ----QAEEVQVNRILPHPKFDPQTFHNDLALVQLWTPVNSEGPARPICLPEGSREPPAGTPCTIA 235

  Fly   149 GWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELLVAD------------DQVLCLGHGRRQ 201
            |||...|.           ..|..|.||.    |..||.||            ..:||.|: ...
  Rat   236 GWGALFED-----------GPESEAVREA----RVPLLSADTCQKALGPGLSPSTMLCAGY-LAG 284

  Fly   202 GI--CSGDIGGPAVY-----QGQLVGLGAQILGE-CG--GMLPERFISIAANYDWIQQQL 251
            ||  |.||.|||...     :.:.|..|....|: ||  |. |..:..:|...||:|:|:
  Rat   285 GIDSCQGDSGGPLTCSEPGPRPREVLFGVTSWGDGCGEPGK-PGVYTRVAVFKDWLQEQM 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 66/248 (27%)
Tryp_SPc 25..250 CDD:238113 67/250 (27%)
Prss56XP_003750778.1 Tryp_SPc 112..342 CDD:238113 67/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.