DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and f9a

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_878288.2 Gene:f9a / 359826 ZFINID:ZDB-GENE-030714-2 Length:503 Species:Danio rerio


Alignment Length:268 Identity:72/268 - (26%)
Similarity:100/268 - (37%) Gaps:64/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PQGRIAGGEDAVLGQLPYQAALSIGGSYN--CGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAV 83
            |:.||.||..|:.|::|:|.||....:..  ||..|:...:.:||..|:..:...:      |.:
Zfish   250 PKSRIIGGNSALPGEIPWQVALVSRSTQQVFCGGSILNPLWVITAAHCLLGNHNGS------FYI 308

  Fly    84 TVGSVDL--YNGKQIRVEEITI--NPNY----STLKTGIALLRLQEEITFSETVNAIPL-----S 135
            .||..|:  ..|.:..|:.|.:  :|.|    |.....||||||:..|..:.||..|.|     |
Zfish   309 RVGEHDVSKIEGTEQNVDVIKLISHPRYNSKVSLFNHDIALLRLRSPIRLTPTVRPICLGPMVFS 373

  Fly   136 QDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQV-------- 192
            ..:...|:...||||||..                 ...|..|...:.||...|..|        
Zfish   374 NTLLQSGTLATVSGWGRVR-----------------FQGRSAATLQKIELPYVDRTVCKESSSDP 421

  Fly   193 -----LCLGHG-RRQGICSGDIGGPAV--YQGQLVGLGAQILG-ECG-----GMLPERFISIAAN 243
                 .|.||. ..:..|.||.|||.|  |.......|....| ||.     |:    :..:...
Zfish   422 ITHFMFCAGHSDSPKDACQGDSGGPHVMRYHNTWFLTGIISWGEECAKKGKYGV----YTQVGNY 482

  Fly   244 YDWIQQQL 251
            |.|||..:
Zfish   483 YRWIQHTM 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 68/259 (26%)
Tryp_SPc 25..250 CDD:238113 70/261 (27%)
f9aNP_878288.2 GLA 19..83 CDD:214503
EGF_CA 84..120 CDD:238011
FXa_inhibition 127..163 CDD:291342
Tryp_SPc 253..486 CDD:214473 68/259 (26%)
Tryp_SPc 254..489 CDD:238113 70/261 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.