DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG17571

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:263 Identity:69/263 - (26%)
Similarity:112/263 - (42%) Gaps:31/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLTLTIGLILVAAGVLEAQPQ-----GRIAGGEDAVLGQLPYQAAL-SIGGSYNCGAVIIGQRYA 60
            :|.|::..::..|......|.     |||..|||..:...|||.:: :..||:.||..:|.....
  Fly     3 RLLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETV 67

  Fly    61 LTALSCVCSDGKDTPWAAVLFAVTVGSVDLYNGKQIRVEEITINP-------NYSTLKTGIALLR 118
            |||..|:.|      :||....|.|||....:|.::    :|:..       |...:...:|:::
  Fly    68 LTAAHCMQS------YAASELQVRVGSTSRSSGGEV----VTVRAFKYHEGYNSKLMINDVAIIK 122

  Fly   119 LQEEITFSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRD 183
            |...:..:..:.||.|:......|:...|||||.|.....:...|||....:::..::||   .|
  Fly   123 LSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCA---AD 184

  Fly   184 ELLVADDQVL----CLGHGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISIAANY 244
            ......|.:|    | ..|.::..|.||.|||.|...:|||:.:...|......|..:..:|:..
  Fly   185 TYNYGSDSILETMVC-ATGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLR 248

  Fly   245 DWI 247
            .||
  Fly   249 SWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 62/234 (26%)
Tryp_SPc 25..250 CDD:238113 63/235 (27%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 62/234 (26%)
Tryp_SPc 31..254 CDD:238113 63/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.