DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG31954

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:279 Identity:77/279 - (27%)
Similarity:120/279 - (43%) Gaps:58/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILVAAGV-LEAQP---------------------QGRIAGGEDAVLGQLPYQAALSIGGSYNCGA 52
            :||.||| |..||                     .|||.||....:...|:|.:|.. .|:.||.
  Fly    14 LLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQT-SSHICGG 77

  Fly    53 VIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVGSVDL-YNGKQIRVEEITINP--NYSTLKTGI 114
            .||.:.:.|||..|......|.      ..|.:|:.:. .:|:.:||::|..:.  ||:.:....
  Fly    78 SIISEEWILTAAHCTYGKTADR------LKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDF 136

  Fly   115 ALLRLQEEITFSETVNAI--PLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPREC 177
            :||:|...|.|.||..|:  |.||.....|....|||||.|.    |:     :.:.|.:...|.
  Fly   137 SLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQ----NL-----LESREWLRQVEV 192

  Fly   178 ALANRDELLVAD---------DQVLCLG--HGRRQGICSGDIGGPAVYQ-GQLVGLGAQILGECG 230
            .|.|::  |.::         ::::|.|  .|.:.. |.||.|||.|.: |:|||:.:...|...
  Fly   193 PLVNQE--LCSEKYKQYGGVTERMICAGFLEGGKDA-CQGDSGGPMVSESGELVGVVSWGYGCAK 254

  Fly   231 GMLPERFISIAANYDWIQQ 249
            ...|..:..::...|||::
  Fly   255 PDYPGVYSRVSFARDWIKE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 66/239 (28%)
Tryp_SPc 25..250 CDD:238113 67/242 (28%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 66/239 (28%)
Tryp_SPc 51..274 CDD:238113 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.