DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and sphe

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:252 Identity:94/252 - (37%)
Similarity:140/252 - (55%) Gaps:19/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IGLI-LVAAGVLEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSD 70
            :||| |.|.|:..|  ||||.|||||......:.|:|.:..::.||..|:.|...||...||..|
  Fly     9 LGLIGLTAVGMCHA--QGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRD 71

  Fly    71 GK--DTPWAAVLFAVTVGSVDLY-NGKQIRVEEITINPNYSTLKTGIALLRLQEEITFSETVNAI 132
            ||  |    |...|..|||.:.| .||.:.||.:.::|:|..|...:|::.|..|:|:::.:.||
  Fly    72 GKLID----ASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNLNNNLAVITLSSELTYTDRITAI 132

  Fly   133 PL---SQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQVLC 194
            ||   .:.:|..||:|.|:|||||::. .|.::..|| :.:|.....|..|..|.    |:|..|
  Fly   133 PLVASGEALPAEGSEVIVAGWGRTSDG-TNSYKIRQI-SLKVAPEATCLDAYSDH----DEQSFC 191

  Fly   195 LGHGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISIAANYDWIQQQL 251
            |.|..::|.|.||.||.|:|...|:||...::|.||...|:.|:.:::..||||:|:
  Fly   192 LAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 81/228 (36%)
Tryp_SPc 25..250 CDD:238113 83/230 (36%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 76/214 (36%)
Tryp_SPc 42..244 CDD:214473 73/211 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.