DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and prss59.1

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:221 Identity:60/221 - (27%)
Similarity:102/221 - (46%) Gaps:24/221 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILVAAGVLEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKD 73
            :.||..|...|....:|.||.:......|:||:|: .|.:.||..::.:.:.::|..|..|    
Zfish     5 VFLVLLGAAFALDDDKIVGGYECQPNSQPWQASLN-SGYHFCGGSLVSEYWVVSAAHCYKS---- 64

  Fly    74 TPWAAVLFAVTVG--SVDLYNGKQ--IRVEEITINPNYST--LKTGIALLRLQEEITFSETVNAI 132
                  ...|.:|  ::.:..|.:  |..|::..||||.:  |.:.|.|::|.:..|.::.|..:
Zfish    65 ------RVEVRLGEHNIVINEGTEQFITSEKVIRNPNYDSWDLDSDIMLIKLSKPATLNKYVQPV 123

  Fly   133 PLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQVLCLGH 197
            .|.......|:...|||||.|..|..:.:: ||.....:::.|:|   |.....:..|.:.|.|:
Zfish   124 ALPNGCAADGTMCRVSGWGNTMSSTADSNK-LQCLEIPILSDRDC---NNSYPGMITDTMFCAGY 184

  Fly   198 --GRRQGICSGDIGGPAVYQGQLVGL 221
              |.:.. |.||.|||.|..|:|.|:
Zfish   185 LEGGKDS-CQGDSGGPVVCNGELHGI 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 56/206 (27%)
Tryp_SPc 25..250 CDD:238113 56/205 (27%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 56/206 (27%)
Tryp_SPc 21..238 CDD:238113 56/205 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.