DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and Klk15

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:278 Identity:72/278 - (25%)
Similarity:112/278 - (40%) Gaps:65/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILVAAGVLEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKD 73
            ::||:|    ||...::..||:.|....|:|.||...|.:||||.:|..|:.|||..|       
Mouse     8 VLLVSA----AQDGDKVLEGEECVPHSQPWQVALFERGRFNCGAFLISPRWVLTAAHC------- 61

  Fly    74 TPWAAVLFAVTVGSVDL--YNG-KQIR-VEEITINPNYS--TLKTGIALLRLQEEITFSETVNAI 132
               ......|.:|..:|  ::| :|:| |..|..:|.|.  |.:..|.||||.:....:..|..:
Mouse    62 ---QTRFMRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRLFKPARLTAYVRPV 123

  Fly   133 PLSQDVPPMGSQVEVSGWGRTTE----------SEVNMHRTLQIGAAEVMAPRECALANRDELLV 187
            .|.:..|.:|....|||||..::          |.|.:..||......:::...|   |:|....
Mouse   124 ALPRRCPLIGEDCVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISEASC---NKDYPGR 185

  Fly   188 ADDQVLCLG-HGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGML----------------PE 235
            ....::|.| .|.....|.||.|||.|               |||.|                |.
Mouse   186 VLPTMVCAGVEGGGTDSCEGDSGGPLV---------------CGGALQGIVSWGDVPCDTTTKPG 235

  Fly   236 RFISIAANYDWIQQQLQQ 253
            .:..:.:..:||.:.:::
Mouse   236 VYTKVCSYLEWIWENVRR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 65/255 (25%)
Tryp_SPc 25..250 CDD:238113 67/257 (26%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 65/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.