DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG6041

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:273 Identity:76/273 - (27%)
Similarity:117/273 - (42%) Gaps:35/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTIGLIL--VAAG-VLEAQPQG----RIAGGEDAVLGQLPYQAAL--------SIGGSYNCGAVI 54
            |.|.|.|  :|:| .|.::..|    :|.||.||.:.|:.||.::        |.|..:.||.|:
  Fly     8 LAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVV 72

  Fly    55 IGQRYALTALSCVCSDGKDTPWAAVLFAVTVGSVDL---------YNGKQIRVEEITINPNYSTL 110
            |.||...||..|.....|.....|..|.:.:||..|         |..:|:...|   |.|...|
  Fly    73 ISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHE---NYNPDAL 134

  Fly   111 KTGIALLRLQEEITFS-ETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAP 174
            ...|||:.:...|.:: .||.|:.|:..:....:...:||||...::......|||.....:::.
  Fly   135 TNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSY 199

  Fly   175 RECALANRDELLVADDQVLCLGHGRRQGI--CSGDIGGPAVYQGQLVGLGAQILGECGGMLPERF 237
            ..|.::...   :...|| |.|: ...|:  |.||.|||....|.|.|:.:...|......|..:
  Fly   200 TTCRISYNS---IPVSQV-CAGY-LSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVY 259

  Fly   238 ISIAANYDWIQQQ 250
            .:::..||||.|:
  Fly   260 TNVSYYYDWIVQK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 65/242 (27%)
Tryp_SPc 25..250 CDD:238113 67/244 (27%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 65/242 (27%)
Tryp_SPc 35..272 CDD:238113 67/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.