DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and Proz

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001296362.1 Gene:Proz / 306608 RGDID:1308666 Length:406 Species:Rattus norvegicus


Alignment Length:194 Identity:41/194 - (21%)
Similarity:82/194 - (42%) Gaps:42/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PYQAALSIG-GSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVGSVDLYNGKQIRVEE 100
            |:|..|:.. |...|..|::.:.:.||...|           ::|.:..  ||...:.:|||::.
  Rat   201 PWQVRLTNSEGEDFCAGVLLQENFVLTTAKC-----------SLLHSNL--SVKADDDQQIRIKS 252

  Fly   101 ITINPNY--STLKTGIALLRLQEEITFSETVNAIPL-------SQDVPPMGSQVEVSGWGRTTES 156
            ..::..|  .|.:..::||.|::.:..  .:.|:|:       ::.|...|::..:|||   ..:
  Rat   253 AHVHMRYDKETGENDVSLLELEKPLQC--PIPALPVCVPERDFAEHVLIPGTKGVLSGW---MLN 312

  Fly   157 EVNMHRTLQIGAAEVMAPRECALANRDELLVADDQVLCLGHGRRQGICSG-DIGGPAVYQGQLV 219
            .:::.|||.:.:.......||.            |:|.:....|.....| ::.||.| :|.:|
  Rat   313 GIDLDRTLTMLSVTQTDGEECG------------QILNVTVTTRTSCEKGSEVMGPWV-EGSVV 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 41/194 (21%)
Tryp_SPc 25..250 CDD:238113 41/194 (21%)
ProzNP_001296362.1 GLA 27..89 CDD:214503
EGF_CA <99..126 CDD:238011
FXa_inhibition 140..169 CDD:291342
Tryp_SPc 199..404 CDD:304450 41/194 (21%)
Trypsin 199..>347 CDD:278516 35/175 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.