DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and Elane

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:263 Identity:71/263 - (26%)
Similarity:111/263 - (42%) Gaps:52/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TLTIGLILVAAGVLEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVC 68
            ::.:.|:||...:     ...|.||..|.....|:..:|...|.:.|||.:|.:.:.::|..|| 
  Rat    17 SMLLALLLVCPAL-----ASEIVGGRPAQPHAWPFMVSLQRRGGHFCGATLIARNFVMSAAHCV- 75

  Fly    69 SDGKDTPWAAVLFAVTVGSVDLYN---GKQI----RVEEITINPNYSTLKTGIALLRLQEEITFS 126
             :|::  :.:|  .|.:|:.||..   .:||    |:.|...:|  |.|...|.:::|..    |
  Rat    76 -NGRN--FQSV--QVVLGAHDLRRREPTRQIFSVQRIFENGFDP--SRLLNDIVIIQLNG----S 129

  Fly   127 ETVNAIPLSQDVPPMGSQV------EVSGWGR--TTESEVNMHRTLQIGAAEVMAPRE---CALA 180
            .|:||.....::|..|..|      ...||||  |.....::.:.|.:.....:..|.   |.|.
  Rat   130 ATINANVQVAELPAQGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVVTNLCRRRVNVCTLV 194

  Fly   181 NRDELLVADDQVLCLGHGRRQGICSGDIGGPAVYQGQLVGLGAQILGECG-GMLPERFISIAANY 244
            .|                |:.|||.||.|||.|....:.|:.:.|.|.|| |..|:.|..:|...
  Rat   195 PR----------------RQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGFYPDAFAPVAEFA 243

  Fly   245 DWI 247
            |||
  Rat   244 DWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 66/241 (27%)
Tryp_SPc 25..250 CDD:238113 68/242 (28%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 66/241 (27%)
Tryp_SPc 33..249 CDD:238113 68/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.