DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and Klk1c3

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:270 Identity:73/270 - (27%)
Similarity:111/270 - (41%) Gaps:45/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILVAA---GVLEAQP--QGRIAGGEDAVLGQLPYQAALSIGGSYN---CGAVIIGQRYALTALS 65
            |||..|   |.::|.|  |.|:.||........|:|.|:     .|   ||.|:|...:.:||..
  Rat     4 LILFLALSLGQIDAAPPGQSRVVGGFKCEKNSQPWQVAV-----INEDLCGGVLIDPSWVITAAH 63

  Fly    66 CVCSDGKDTPWAAVLFAVTVGSVDLYNGKQIR-VEEITINPNYSTL------------KTGIALL 117
            |. ||.         :.|.:|..:|....|.| |.:...:|:|...            ...:.||
  Rat    64 CY-SDN---------YHVLLGQNNLSEDVQHRLVSQSFRHPDYKPFLMRNHTRKPKDYSNDLMLL 118

  Fly   118 RLQEEITFSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANR 182
            .|.|....::.|..|.|....|.:||...|||||.|..||......||.....:::..:|..|.:
  Rat   119 HLSEPADITDGVKVIDLPTKEPKVGSTCLVSGWGSTNPSEWEFPDDLQCVNIHLLSNEKCIKAYK 183

  Fly   183 DELLVADDQVLCLGH---GRRQGICSGDIGGPAVYQGQLVGLGAQILGECG-GMLPERFISIAAN 243
            :::   .|.:||.|.   |:  ..|.||.|||.:..|.|.|:.:.....|| ...|..:..:...
  Rat   184 EKV---TDLMLCAGELEGGK--DTCRGDSGGPLICDGVLQGITSWGSVPCGEPNKPGIYTKLIKF 243

  Fly   244 YDWIQQQLQQ 253
            ..||::.:::
  Rat   244 TSWIKEVMKK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 63/242 (26%)
Tryp_SPc 25..250 CDD:238113 64/244 (26%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 63/242 (26%)
Tryp_SPc 25..250 CDD:238113 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.