DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and Klk10

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:234 Identity:52/234 - (22%)
Similarity:92/234 - (39%) Gaps:33/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVGS--VDLYNGKQIR-V 98
            |:|.:|.....:.|..|::.|.:.|||..|         |........||.  :.|:..:|:| .
  Rat    59 PWQVSLFHNLQFQCAGVLVDQNWVLTAAHC---------WRNKPLRARVGDDHLLLFQSEQLRST 114

  Fly    99 EEITINPNYSTL----------KTGIALLRLQEEITFSETVNAIPLSQDVPPMGSQVEVSGWGRT 153
            .....:|.|...          :..:.:|:|...:..:..|:.:.|.........:.:|||||.|
  Rat   115 NSPVFHPKYQPCSGPVLPLRSDEHDLMMLKLSSPVVLTSKVHPVQLPFQCAQPRQECQVSGWGTT 179

  Fly   154 TESEVNMHRTLQIGAAEVMAPRECALANRDELL---VADDQVLCLGHGRRQGICSGDIGGPAVYQ 215
            ....|..:|:|......:::.::|      |..   |..:.::|.|..|.|..|..|.|||.|..
  Rat   180 ANRRVKYNRSLSCSRVTLLSQKQC------ETFYPGVITNNMICAGMDRDQDSCQSDSGGPLVCD 238

  Fly   216 GQLVGLGAQILGECGG--MLPERFISIAANYDWIQQQLQ 252
            ..|.|:.:..:..||.  ..|..:..|....:||::.::
  Rat   239 NTLHGILSWSIYPCGAATQYPAVYAKICNYTNWIRRVIR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 50/227 (22%)
Tryp_SPc 25..250 CDD:238113 52/230 (23%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 50/227 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.