DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and Klk11

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:268 Identity:60/268 - (22%)
Similarity:106/268 - (39%) Gaps:36/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTLTIGLILVAAGVLEAQPQGRIAGGEDAVL-------GQLPYQAALSIGGSYNCGAVIIGQR 58
            |.:...|.|.||...|          |||..::       ...|:|.||.......|||.:|..:
  Rat    30 MMILRFIALALVTGHV----------GGETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPK 84

  Fly    59 YALTALSCVCSDGKDTPWAAVLFAVTVGSVDLYNGKQIRVEEITINPNYSTL------KTGIALL 117
            :.|||..|     :...:..:|....:...|....:::..|... :|.::..      :..|.|:
  Rat    85 WLLTAAHC-----RKPHYVILLGEHNLEKTDGCEQRRMATESFP-HPGFNNSLPNKDHRNDIMLV 143

  Fly   118 RLQEEITFSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANR 182
            ::......:..|..:.||......|:...:||||.|:..::.:..:|:.....::..:||..|..
  Rat   144 KMSSPAFITRAVRPLTLSSLCVTAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIGHKECERAYP 208

  Fly   183 DELLVADDQVLCLGHGRRQG--ICSGDIGGPAVYQGQLVGLGAQILGECG-GMLPERFISIAANY 244
            ..:   .|.:|| ...|::|  .|.||.|||.|..|.|.|:.:.....|. ...|..:..:...:
  Rat   209 GNI---TDTMLC-ASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYF 269

  Fly   245 DWIQQQLQ 252
            |||.:.::
  Rat   270 DWIHEVMR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 52/238 (22%)
Tryp_SPc 25..250 CDD:238113 54/240 (23%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 49/231 (21%)
Tryp_SPc 51..275 CDD:238113 51/233 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.