DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and Prss38

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:269 Identity:53/269 - (19%)
Similarity:103/269 - (38%) Gaps:64/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QP--QGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFA 82
            ||  .|::.|||..:..:.|:|.::...|.:.||..|:...:.|||..|...:.:          
  Rat   107 QPALHGKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVLTAAHCFAREKR---------- 161

  Fly    83 VTVGSVDLYNG-----------KQIRVEEITINPNYSTLKT---GIALLRLQEEITFSETVNAIP 133
              :.:.|:|.|           :...:.::.|:|.:.....   .:||::.:..|.||:.|..|.
  Rat   162 --LQTFDMYVGITNLEVANKHTQWFEINQVIIHPTFEMFHPVGGDVALVQSKSAIVFSDYVLPIC 224

  Fly   134 L-SQDVPPMGSQVEVSGWGRTT----------ESEVNMHRTLQ----IGAAEVMAPRECALANRD 183
            | |.::.........:|||..:          |:::.:....|    .|....:.|         
  Rat   225 LPSSNLNLSDLSCWTTGWGMVSPQGETGKDLLEAQLPLIPKFQCQLLYGLTSYLLP--------- 280

  Fly   184 ELLVADDQVLCLGHGRR-QGICSGDIGGPAVYQGQLVGLGAQIL----GECGGMLPERFISIAAN 243
                   ::||.|..:. :.:|.||.|.|.|.:.....|...|:    |....:.|..|.:::..
  Rat   281 -------EMLCAGDIKNMKNVCEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYF 338

  Fly   244 YDWIQQQLQ 252
            .:||:..::
  Rat   339 LNWIRYNME 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 48/256 (19%)
Tryp_SPc 25..250 CDD:238113 50/258 (19%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 49/254 (19%)
Tryp_SPc 116..342 CDD:214473 48/253 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.