DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and Prss34

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:288 Identity:78/288 - (27%)
Similarity:114/288 - (39%) Gaps:73/288 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTLTIGLILVAAGVLEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYN---------CGAVIIG 56
            |.||...|..||.           |.||......:.|:|.:|..   ||         ||..:|.
  Rat    20 MPLTPDSGQELVG-----------IVGGCPVSASRFPWQVSLRF---YNMKLSKWEHICGGSLIH 70

  Fly    57 QRYALTALSCVCSDGKDTPWAAVLFAVTVGSVDLYNGKQI-RVEEITINPNYSTLKTG-----IA 115
            .::.|||..||  :.|:  ..|..|.|.||.:.||...|: :|.:|..:|.:|...:.     ||
  Rat    71 PQWVLTAAHCV--ELKE--MEASCFRVQVGQLRLYENDQLMKVAKIIRHPKFSEKLSAPGGADIA 131

  Fly   116 LLRLQEEITFSETVNAIPLSQDVPPMGSQVE------VSGWGRTTESEVNMHRTL--QIGAAEVM 172
            ||:|...:..||.|:.:.|    |....::.      |:|||     .:..||.|  .....||.
  Rat   132 LLKLDSTVVLSERVHPVSL----PAASQRISSKKTWWVAGWG-----VIEGHRPLPPPCHLREVA 187

  Fly   173 AP-----------RECALANRDELLVADDQVLCLGHGRRQGICSGDIGGPAVYQGQL----VGLG 222
            .|           |..:..:|...::.|| :||.|...|.. |..|.|||.|.:...    ||:.
  Rat   188 VPIVGNSDCEQKYRTYSSLDRTTKIIKDD-MLCAGMEGRDS-CQADSGGPLVCRWNCSWVQVGVV 250

  Fly   223 AQILGECGGMLPE---RFISIAANYDWI 247
            :..:| ||  ||:   .:..:.:...||
  Rat   251 SWGIG-CG--LPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 70/263 (27%)
Tryp_SPc 25..250 CDD:238113 72/264 (27%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 72/264 (27%)
Tryp_SPc 33..275 CDD:214473 70/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.