DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and f10

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_958870.3 Gene:f10 / 282670 ZFINID:ZDB-GENE-021206-9 Length:504 Species:Danio rerio


Alignment Length:227 Identity:55/227 - (24%)
Similarity:96/227 - (42%) Gaps:48/227 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VLEAQP---------QGRIAGGEDAVLGQLPYQAALSIGGSYN-CGAVIIGQRYALTALSCVCSD 70
            ::|.:|         .|||..|.:...|..|:||.|....:.. ||..|:.:.:.|:|..|:.. 
Zfish   227 IIEEEPILPVVSTAGDGRIVNGVECPPGDCPWQALLINENNMGFCGGTILTEHFILSAAHCMNE- 290

  Fly    71 GKDTPWAAVLFAVTVGSVD--LYNGKQIR--VEEITINPNY--STLKTGIALLRLQEEITFSETV 129
                   ::...|.||..|  :..|::..  |:||.|:.||  .|....|||::|.:.|.|::.:
Zfish   291 -------SLSIRVVVGEYDTLVPEGREATHDVDEILIHKNYQPDTYHNDIALIKLSKPIKFTKYI 348

  Fly   130 NAIP-------LSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELLV 187
              ||       .::.|........|||:||..|..:         ::.::........||.:.:.
Zfish   349 --IPACLPEMKFAERVLMQQDDGLVSGFGRVREGGL---------SSTILQKLTVPYVNRAKCIE 402

  Fly   188 ADD-----QVLCLGHGRRQ-GICSGDIGGPAV 213
            :.:     ::.|.|:.:.: ..|.||.|||.|
Zfish   403 SSNFKISGRMFCAGYDQEEKDACQGDSGGPHV 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 52/210 (25%)
Tryp_SPc 25..250 CDD:238113 51/209 (24%)
f10NP_958870.3 GLA 19..82 CDD:214503
EGF_CA 83..119 CDD:238011
FXa_inhibition 126..161 CDD:291342
Tryp_SPc 244..472 CDD:214473 52/210 (25%)
Tryp_SPc 245..474 CDD:238113 51/209 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.