DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG33459

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:254 Identity:62/254 - (24%)
Similarity:98/254 - (38%) Gaps:48/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVGSV 88
            ||.||.||.|...|:.|.|.....:.||..:|...:.|||..||....|:       ..|.:|..
  Fly    37 RIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPTPKN-------LTVRLGEY 94

  Fly    89 D----------LYNGKQIRVEEITINPNYSTLKT-GIALLRLQEEITFSETVNAIPLSQDVPP-- 140
            |          .:..::..|..|..:|:|.::.. .||||:|.:.:.:  ||...|:...:|.  
  Fly    95 DWTRQMDSINPKHRHREYMVTRIYTHPSYRSIAAYDIALLKLNQTVEY--TVAIRPICLVLPENF 157

  Fly   141 -----MGSQVE---VSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQV-LCLG 196
                 :...||   ::|||.|....|:  :.||......:....|    .|....:.|.. :|.|
  Fly   158 HEWYWLVDSVEDFTLTGWGATKTEPVS--QVLQSANLTQIDRGTC----HDRYGHSVDHTHICAG 216

  Fly   197 HGRRQGICSGDIGGPAV--------YQGQLVGLGAQILGECGGMLPERFISIAANYDWI 247
             ..:...|.||.|.|..        |....||:.::....|.|:..  |.::.:..:||
  Fly   217 -SSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGVTV--FTNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 60/252 (24%)
Tryp_SPc 25..250 CDD:238113 61/253 (24%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 60/252 (24%)
Tryp_SPc 38..272 CDD:238113 59/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.