DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG33458

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:269 Identity:61/269 - (22%)
Similarity:101/269 - (37%) Gaps:71/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVG-- 86
            ||.||.|:.|...|:.|.|.|...:.||..::...:.|||..|.....     |.||  |.:|  
  Fly    37 RITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDKN-----AKVL--VRLGEN 94

  Fly    87 ----SVDLYNGK------QIRVEEITINPNYSTLK-TGIALLRLQEEITFSETVNAIPLSQDVPP 140
                .:|....:      :..:.:..|:|.|.|.. ..|||.:|...:.:::::..|.|..: |.
  Fly    95 DASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHYYDIALAKLNRYVVYTDSIRPICLMLN-PN 158

  Fly   141 MGSQVE------VSGWGRTTESEVN----MHRTLQIGAAEVMAPRECALANRDEL-------LVA 188
            ....|:      ::|||.|..|||:    :.|..||                |..       .:.
  Fly   159 WQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQI----------------DRFTCRYWFGYMV 207

  Fly   189 DDQVLCLGHGRRQGICSGDIGGPAVYQGQLV-----------GLGAQILGECGGMLPERFISIAA 242
            |...:|.|..:.. :..||.|||.   |.:|           |:.:.:.....|:  ..|.:|.:
  Fly   208 DRTHICAGESKHY-VGKGDSGGPL---GSMVDYKYAKRFFQFGIVSHLRQPFHGV--SVFTNILS 266

  Fly   243 NYDWIQQQL 251
            ..:||.:.:
  Fly   267 YSNWIHRTI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 59/263 (22%)
Tryp_SPc 25..250 CDD:238113 60/265 (23%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 59/263 (22%)
Tryp_SPc 38..274 CDD:238113 60/265 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.