DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and Proc

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_008770240.3 Gene:Proc / 25268 RGDID:3411 Length:500 Species:Rattus norvegicus


Alignment Length:263 Identity:74/263 - (28%)
Similarity:112/263 - (42%) Gaps:48/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LEAQPQGRIAGGEDAVLGQLPYQA-ALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVL 80
            ||..|  ||..|.....|..|:|| .|.......||.|:|...:.|||..|:.|..|.|      
  Rat   246 LELGP--RIVNGTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHCLESSKKLT------ 302

  Fly    81 FAVTVGSVDLYNGK----QIRVEEITINPNY--STLKTGIALLRLQEEITFSETVNAIP------ 133
              |.:|..||....    .:.::|:.::|||  |.....||||||.:..|.|:|:  :|      
  Rat   303 --VRLGEYDLRRRDPWELDLDIKEVLVHPNYTRSNSDNDIALLRLSQPATLSKTI--VPICLPNS 363

  Fly   134 -LSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELL-----VADDQV 192
             |:|::...|.:..|:|||..::...:..|........:..|    ||.|::.:     |..:.:
  Rat   364 GLAQELSQAGQETVVTGWGYQSDKVKDGRRNRTFILTFIRIP----LAARNDCMQVMNNVVSENM 424

  Fly   193 LCLG-HGRRQGICSGDIGGPAV--YQGQLVGLGAQILGE-CG-----GMLPERFISIAANYDWIQ 248
            ||.| .|..:..|.||.|||.|  ::|....:|....|| ||     |:    :..:.:...||.
  Rat   425 LCAGIIGDTRDACDGDSGGPMVVFFRGTWFLVGLVSWGEGCGHLNNYGV----YTKVGSYLKWIH 485

  Fly   249 QQL 251
            ..:
  Rat   486 SYI 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 69/250 (28%)
Tryp_SPc 25..250 CDD:238113 70/252 (28%)
ProcXP_008770240.3 GLA 65..125 CDD:214503
EGF_CA 126..170 CDD:238011
FXa_inhibition 178..213 CDD:405372
Tryp_SPc 252..486 CDD:238113 70/251 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.