DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and CG30031

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster


Alignment Length:260 Identity:65/260 - (25%)
Similarity:107/260 - (41%) Gaps:25/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLTLTIGLILVAAG-----VLEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYA 60
            :|..:.:..:..|.|     .|..|..|||.||....:...|:|.:|...||::||..|......
  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66

  Fly    61 LTALSCVCS--------DGKDTPWAAVLFAVTVGSVDLYNGKQIRVEEITINPNYSTLKTGIALL 117
            :||..|:.|        ....:.|::.....:|.|...:.|.           |.:|:...||::
  Fly    67 VTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGY-----------NANTMVNDIAII 120

  Fly   118 RLQEEITFSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANR 182
            ::...:|||.|:.||.|:...|..|:...|||||..:....::...||.....:::..:||.:..
  Fly   121 KINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTY 185

  Fly   183 DELLVADDQVLCLGHGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISIAANYDWI 247
            .........::|.....:.. |.||.|||.|..|.|||:.:...|......|..:..:||...|:
  Fly   186 GYGSQIRSTMICAAASGKDA-CQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249

  Fly   248  247
              Fly   250  249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 58/230 (25%)
Tryp_SPc 25..250 CDD:238113 58/231 (25%)
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 58/230 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.