DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and Prss38

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:267 Identity:67/267 - (25%)
Similarity:113/267 - (42%) Gaps:48/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VAAGVLEAQP--QGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDT 74
            ||.|    ||  ||::.|||.|...:.|:|.:|...|.:.||..|:...:.|:|..|. ..||..
Mouse    45 VACG----QPVLQGKLLGGEFARDRKWPWQVSLHYSGFHICGGSILSAYWVLSAAHCF-DRGKKL 104

  Fly    75 PWAAVLFAVTVGSVDLYNGKQ----IRVEEITINPN---YSTLKTGIALLRLQEEITFSETVNAI 132
            .    .:.:.||..:|....:    ..:.::.|:|.   |..:...:||::|:..|.||:.|  :
Mouse   105 E----TYDIYVGITNLEKANRHTQWFEIYQVIIHPTFQMYHPIGGDVALVQLKSAIVFSDFV--L 163

  Fly   133 PLSQDVPP-----MGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPR-ECALAN-------RDE 184
            |:.  :||     :......:|||..:......:..|:  |...:.|| :|.|..       .:.
Mouse   164 PIC--LPPSDLYLINLSCWTTGWGMISPQGETGNELLE--AQLPLIPRFQCQLLYGLSSYLLPEM 224

  Fly   185 LLVADDQVLCLGHGRRQGICSGDIGGPAV-YQGQL---VGLGAQILGECGGMLPERFISIAANYD 245
            |..||.:.:       :.:|.||.|.|.| .|.|.   :|:.:...|....:.|..|.:::....
Mouse   225 LCAADIKTM-------KNVCEGDSGSPLVCKQNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLS 282

  Fly   246 WIQQQLQ 252
            ||:..||
Mouse   283 WIRYHLQ 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 56/246 (23%)
Tryp_SPc 25..250 CDD:238113 58/248 (23%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 58/246 (24%)
Tryp_SPc 58..284 CDD:214473 56/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.