DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and Prtn3

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:263 Identity:75/263 - (28%)
Similarity:114/263 - (43%) Gaps:48/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILVAAGVLEAQPQGRIAGGEDAVLGQLPYQAALSIG---GSYNCGAVIIGQRYALTALSCVCSD 70
            |.||..|.::|   .:|.||.:|.....||.|:|.:.   ||:.||..:|..|:.|||..|:   
Mouse    17 LALVVGGAVQA---SKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVLTAAHCL--- 75

  Fly    71 GKDTPWAAVLFAVTVGSVDLYNGKQIRVEEITINP----NYSTLK--TGIALLRLQEEITFSE-- 127
             :|..|.  |..|.:|:.||.:.:. ..::.||:.    ||:..:  ..:.||:|....:..:  
Mouse    76 -QDISWQ--LVTVVLGAHDLLSSEP-EQQKFTISQVFQNNYNPEENLNDVLLLQLNRTASLGKEV 136

  Fly   128 TVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQV 192
            .|.::|........|:|....|||| ..::....|.||                  ||.|.....
Mouse   137 AVASLPQQDQTLSQGTQCLAMGWGR-LGTQAPTPRVLQ------------------ELNVTVVTF 182

  Fly   193 LCLGHG-------RRQGICSGDIGGPAVYQGQLVGLGAQILGECGGM-LPERFISIAANYDWIQQ 249
            ||..|.       |..|||.||.|||.:..|.|.|:.:.::.||..: .|:.|..::...||||.
Mouse   183 LCREHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVDWIQN 247

  Fly   250 QLQ 252
            .|:
Mouse   248 VLR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 66/241 (27%)
Tryp_SPc 25..250 CDD:238113 69/243 (28%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 66/241 (27%)
Tryp_SPc 30..248 CDD:238113 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.