DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and F9

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:253 Identity:60/253 - (23%)
Similarity:103/253 - (40%) Gaps:47/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVG-- 86
            |:.|||:|..||:|:|..|:......||..||.:::.:||..|:....|        ..|..|  
Mouse   236 RVVGGENAKPGQIPWQVILNGEIEAFCGGAIINEKWIVTAAHCLKPGDK--------IEVVAGEY 292

  Fly    87 SVDLYNGKQIRVEEITINPNYSTLKT------GIALLRLQEEITFSETVNAIPLSQD-----VPP 140
            ::|.....:.|...|...|::....|      .||||.|.:.:..:..|..|.::..     ...
Mouse   293 NIDKKEDTEQRRNVIRTIPHHQYNATINKYSHDIALLELDKPLILNSYVTPICVANREYTNIFLK 357

  Fly   141 MGSQVEVSGWGRTTES--EVNMHRTLQIGAAEVMAPRECALANRDELLVADDQVLCLGHGRRQG- 202
            .||.. |||||:....  :.::.:.|::    .:..|...|  |.......:.:.|.|:  |:| 
Mouse   358 FGSGY-VSGWGKVFNKGRQASILQYLRV----PLVDRATCL--RSTTFTIYNNMFCAGY--REGG 413

  Fly   203 --ICSGDIGGPAVYQGQLVGLGAQILG---ECG-----GMLPERFISIAANYDWIQQQ 250
              .|.||.|||.|.:.:.......|:.   ||.     |:    :..::...:||:::
Mouse   414 KDSCEGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGI----YTKVSRYVNWIKEK 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 58/248 (23%)
Tryp_SPc 25..250 CDD:238113 59/250 (24%)
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:291342
Tryp_SPc 236..464 CDD:214473 58/248 (23%)
Tryp_SPc 237..467 CDD:238113 59/250 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.