DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and f7

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_571894.2 Gene:f7 / 114423 ZFINID:ZDB-GENE-010814-1 Length:433 Species:Danio rerio


Alignment Length:251 Identity:74/251 - (29%)
Similarity:108/251 - (43%) Gaps:40/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVG 86
            :.||.||.:...|..|:|..|..|....||.||....:.|||..|:      .........:..|
Zfish   193 RSRIVGGSECPKGHCPWQVLLKYGEKGFCGGVIYKPTWILTAAHCL------EKLKVKFLRIVAG 251

  Fly    87 SVDLY--NGKQ--IRVEEITINPNY--STLKTGIALLRLQEEITFSETVNAIPLSQDVPPMG--- 142
            ..||.  .|.:  |:|:::..:|.|  .|..:.||||||:..|.:|  |.|:|:...:..|.   
Zfish   252 EHDLEVDEGTEQLIQVDQMFTHPAYVSETADSDIALLRLRTPIVYS--VYAVPVCLPLREMAERE 314

  Fly   143 ----SQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPR----ECALANRDELLVADDQVLCLGH-G 198
                |:..|||||:.:| :....|.|:    .::.||    ||...:.   |.....:.|.|: .
Zfish   315 LWAVSKHTVSGWGKRSE-DGPTSRLLR----RLLVPRIRTQECVQVSN---LTLTSNMFCAGYIE 371

  Fly   199 RRQGICSGDIGGPAV--YQGQLVGLGAQILGECGGMLPERF--ISIAANY-DWIQQ 249
            .||..|.||.|||.|  |:.....||....|: |...|..:  .:..:|| .||:|
Zfish   372 GRQDSCKGDSGGPLVTRYRDTAFLLGIVSWGK-GCARPGSYGIYTRVSNYLQWIRQ 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 71/245 (29%)
Tryp_SPc 25..250 CDD:238113 73/248 (29%)
f7NP_571894.2 GLA 19..82 CDD:214503
EGF_CA 86..121 CDD:238011
FXa_inhibition 131..166 CDD:291342
Tryp_SPc 195..424 CDD:214473 71/245 (29%)
Tryp_SPc 196..427 CDD:238113 73/248 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.