DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and LOC101730792

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_031762443.1 Gene:LOC101730792 / 101730792 -ID:- Length:146 Species:Xenopus tropicalis


Alignment Length:145 Identity:38/145 - (26%)
Similarity:62/145 - (42%) Gaps:14/145 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 ALLRLQEEITFSETVNAIPLS-QDVPPM-GSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPREC 177
            |||.|.....::..|:.:||. |.|.|: |...:|||||.|:........||:.....::..|:|
 Frog     7 ALLPLNRPAFYNAFVSVVPLPIQGVSPIEGRLCQVSGWGFTSTIGGKPSDTLRSVKLPIVPMRKC 71

  Fly   178 ----ALANRDELLVADDQVLCLGH--GRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPER 236
                :.|..     ....::|.|.  |.:.. |.||.|||.|..|::.|:.:..........|..
 Frog    72 NSSASYAGH-----ITSNMICAGFITGGKDA-CQGDSGGPLVCDGKVYGVVSWGHSCANPKYPGV 130

  Fly   237 FISIAANYDWIQQQL 251
            :.::|....||.:.:
 Frog   131 YTAVANFQRWIYRTI 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 36/139 (26%)
Tryp_SPc 25..250 CDD:238113 38/142 (27%)
LOC101730792XP_031762443.1 Tryp_SPc <7..141 CDD:214473 36/139 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.