DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and f7l

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001083027.2 Gene:f7l / 100038778 ZFINID:ZDB-GENE-070424-102 Length:431 Species:Danio rerio


Alignment Length:228 Identity:69/228 - (30%)
Similarity:99/228 - (43%) Gaps:54/228 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VAAGVLEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPW 76
            ||.||     ..||..|:....||.|:||.|...|.|.||.||:..::.:||..|:..  ||...
Zfish   187 VAKGV-----GPRIVKGDVCPKGQCPWQALLEYDGQYKCGGVILNSQWIITAAHCIWR--KDPAL 244

  Fly    77 AAVLFAVTVGSVDLYNGKQIRVEEITINP--NYSTLKTGIALLRLQEEI---------------- 123
            ..|:....:...|....:..:|.|:.::|  |:|:..:.:|||||...:                
Zfish   245 LQVIVGEHIRDRDEGTEQMRKVSEVFLHPQYNHSSTDSDVALLRLHRPVTLGPYALPVCLPPPNG 309

  Fly   124 TFSETVNAIPLSQDVPPMGSQVEVSGWGRTTES--EVNMHRTLQIGAAEVMAPR----ECALANR 182
            |||.|:.:|.:|          .||||||..:|  ...:.:.||:       ||    :|..  |
Zfish   310 TFSRTLASIRMS----------TVSGWGRLAQSGPPSTVLQRLQV-------PRVSSEDCRA--R 355

  Fly   183 DELLVADDQVLCLG--HGRRQGICSGDIGGPAV 213
            ..|.|:.: :||.|  .|.|.. |.||.|||.|
Zfish   356 SGLTVSRN-MLCAGFAEGGRDS-CQGDSGGPLV 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 65/216 (30%)
Tryp_SPc 25..250 CDD:238113 64/215 (30%)
f7lNP_001083027.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.