DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9672 and gzm3.4

DIOPT Version :9

Sequence 1:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001108167.1 Gene:gzm3.4 / 100001210 ZFINID:ZDB-GENE-070912-136 Length:251 Species:Danio rerio


Alignment Length:265 Identity:67/265 - (25%)
Similarity:119/265 - (44%) Gaps:38/265 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IGLILVAAGVLE-AQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSD 70
            |.:||::..|:: ...:..|.||.:..|...||.|:|.:...:|||.::|.:.|.||:..|    
Zfish     6 ICIILISYSVIKTGGMESGIVGGREVKLHSRPYMASLQVQRKHNCGGILIKEDYVLTSAHC---- 66

  Fly    71 GKDTPWAAVLFAVTVGSVDL---YNGKQ-IRVEEITINPNYSTLKTG--IALLRLQEEITFSETV 129
            .|||    ....|.:|:.::   .|.:| |:|::...:|||......  |.||:|:.:...:..|
Zfish    67 WKDT----TNLEVVLGAHNISQRENSQQIIQVQKYIKHPNYQKKNHSFDIMLLKLKTKAVLNHFV 127

  Fly   130 NAIPLSQDVPPMGSQVE--VSGWGRTTESEVNMHRTLQIGAAEVMAPRECAL--------ANRDE 184
            |...|.:..|.:.:.||  ::|||.....|         ||:.|:  ||..|        .::.:
Zfish   128 NITNLPKHEPSILAPVECSIAGWGMQRPGE---------GASNVL--REVNLQLESNSYCKSKWQ 181

  Fly   185 LLVADDQVLCLGHGRRQGICSGDIGGPAVYQGQLVGLGAQIL-GECG-GMLPERFISIAANYDWI 247
            :......::|.....::..|.||.|.|.....:|.|:.|... ..|. ...||.::.::|...||
Zfish   182 VYFNSKNMVCTASDGKKAFCQGDSGSPLFCNSELYGMAAYTYPNNCTFKEYPEVYMKVSAFLPWI 246

  Fly   248 QQQLQ 252
            ::.::
Zfish   247 KKNMK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 61/240 (25%)
Tryp_SPc 25..250 CDD:238113 63/242 (26%)
gzm3.4NP_001108167.1 Tryp_SPc 25..249 CDD:238113 63/242 (26%)
Tryp_SPc 25..246 CDD:214473 61/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.