DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and KLK4

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_004908.4 Gene:KLK4 / 9622 HGNCID:6365 Length:254 Species:Homo sapiens


Alignment Length:224 Identity:65/224 - (29%)
Similarity:103/224 - (45%) Gaps:22/224 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVG----SIQRLTGGQ 95
            |||...:|.......|.|.|:..:|:|:||||..          .||.:.:|    ...:..|.|
Human    41 SQPWQAALVMENELFCSGVLVHPQWVLSAAHCFQ----------NSYTIGLGLHSLEADQEPGSQ 95

  Fly    96 LVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQV 160
            :|..|..:.|..|:.  .:.:|||.|::|:.||..:.....|.:|::.|.||:..:.|||| ...
Human    96 MVEASLSVRHPEYNR--PLLANDLMLIKLDESVSESDTIRSISIASQCPTAGNSCLVSGWG-LLA 157

  Fly   161 DGSLSHVLQVATRQSLSASDCQTELY--LQQEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGI 223
            :|.:..|||......:|...| ::||  |....:.|... .:|....|:||:|.|...|..|.|:
Human   158 NGRMPTVLQCVNVSVVSEEVC-SKLYDPLYHPSMFCAGG-GQDQKDSCNGDSGGPLICNGYLQGL 220

  Fly   224 AAFFVSGCGS-EQPDGYVDVTQHLEWINE 251
            .:|..:.||. ..|..|.::.:..|||.:
Human   221 VSFGKAPCGQVGVPGVYTNLCKFTEWIEK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 65/224 (29%)
Tryp_SPc 30..249 CDD:214473 63/220 (29%)
KLK4NP_004908.4 Tryp_SPc 31..250 CDD:238113 65/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.