DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and prss60.1

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:246 Identity:71/246 - (28%)
Similarity:101/246 - (41%) Gaps:52/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GSQPHSISLRR--NGVHVCGGALIREKWILTAAHC----------VSLGGGQQSYPAKSYNVRVG 86
            ||.|..:||..  .|.|.|||:||..:|:||||||          |.||...|.      .|...
Zfish    43 GSWPWQVSLHSPIYGGHFCGGSLINSEWVLTAAHCLPRITTSSLLVFLGKTTQQ------GVNTY 101

  Fly    87 SIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPA--AGSQ 149
            .|.|       .:|.|.:|.:|  ::....||:|||.|.::|..:....|:.||.:...  .|:.
Zfish   102 EINR-------TVSVITVHPSY--NNLTNENDIALLHLSSAVTFSNYIRPVCLAAQNSVFPNGTS 157

  Fly   150 IIFSGWGSSQVDGSL--SHVLQVATRQSLSASDCQTELYLQQ--EDLLCLSPVDEDFAGL----- 205
            ...:|||:.|:..:|  ..:||......:....|...|....  .:::|        |||     
Zfish   158 SWITGWGNIQLGVNLPAPGILQETMIPVVPNDQCNALLGSGSVTNNMIC--------AGLLQGGR 214

  Fly   206 --CSGDAGAPASYNNQLVGIAAFFVS---GCGSE-QPDGYVDVTQHLEWIN 250
              |.||:|.|......||.:.:...|   ||... .|..|..|:|:..|||
Zfish   215 DTCQGDSGGPMVSKQCLVWVQSGITSWGYGCADPYSPGVYTRVSQYQSWIN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 71/246 (29%)
Tryp_SPc 30..249 CDD:214473 68/243 (28%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 68/243 (28%)
Tryp_SPc 34..267 CDD:238113 71/246 (29%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.